MAJOR ALLERGEN EQU C 1 Recombinant Protein (Horse) (OPCA04557)

Catalog No: OPCA04557

Product Info

• Predicted Species Reactivity: Equus caballus|Horse
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Equus caballus (Horse)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA
• Protein Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 16-187 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Biochemical characterization and surfactant properties of horse allergens.Goubran Botros H., Poncet P., Rabillon J., Fontaine T., Laval J.-M., David B.Eur. J. Biochem. 268:3126-3136(2001)

Target Info

• Gene Symbol: LOC100034197
• Gene Full Name: Equ c1
• Alias Symbols: major allergen Equ c 1.
• NCBI Gene Id: 100034197
• Protein Name: Major allergen Equ c 1
• Uniprot ID: Q95182
• Protein Accession #: NP_001075966
• Nucleotide Accession #: NM_001082497
• Protein Size (# AA): Recombinant
• Molecular Weight: 22.1 kDa