Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP61404_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61404_P050-FITC Conjugated

ARP61404_P050-HRP Conjugated

ARP61404_P050-Biotin Conjugated

MAGI2 Antibody - N-terminal region (ARP61404_P050)

Catalog#: ARP61404_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11526 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data ARP61404_P050
Peptide Sequence Synthetic peptide located within the following region: EEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Catalog # AAP61404 (Previous Catalog # AAPP47522)
Datasheets/Manuals Printable datasheet for ARP61404_P050
Sample Type Confirmation

MAGI2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Publications

Doukhanine, E., Gavino, C., Haines, J. D., Almazan, G. & Richard, S. The QKI-6 RNA binding protein regulates actin-interacting protein-1 mRNA stability during oligodendrocyte differentiation. Mol. Biol. Cell 21, 3029-40 (2010). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20631256

Gene Symbol MAGI2
Official Gene Full Name Membrane associated guanylate kinase, WW and PDZ domain containing 2
Alias Symbols ACVRIP1, AIP1, ARIP1, MAGI-2, SSCAM, AIP-1
NCBI Gene Id 9863
Protein Name Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
Description of Target The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family.
Swissprot Id Q86UL8
Protein Accession # NP_036433
Nucleotide Accession # NM_012301
Protein Size (# AA) 1455
Molecular Weight 160kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis
RNA Seq Find tissues and cell lines supported by RNA-seq analysis
Protein Interactions BAI1; ARRDC3; CTNNB1; ADRB1; DSCAML1; PLXNB3; RAPGEF2; MAGI2; CTNND2; TGFA; GRID2; ATN1; DLL1; SMAD3; PTEN; ACVR2A;
  1. What is the species homology for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAGI2 Antibody - N-terminal region (ARP61404_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    This target may also be called "ACVRIP1, AIP1, ARIP1, MAGI-2, SSCAM, AIP-1" in publications.

  5. What is the shipping cost for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "160kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MAGI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAGI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAGI2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAGI2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAGI2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAGI2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAGI2 Antibody - N-terminal region (ARP61404_P050)
Your Rating
We found other products you might like!