Loading...
Catalog No: ARP61404_P050
Price: $0.00
SKU
ARP61404_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP61404_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: EEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEE
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP61404 (Previous Catalog # AAPP47522)
Sample Type Confirmation

MAGI2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Publications

Corticosteroid treatment exacerbates nephrotic syndrome in a zebrafish model of magi2a knockout. Kidney Int. 95, 1079-1090 (2019). 31010479

Doukhanine, E., Gavino, C., Haines, J. D., Almazan, G. & Richard, S. The QKI-6 RNA binding protein regulates actin-interacting protein-1 mRNA stability during oligodendrocyte differentiation. Mol. Biol. Cell 21, 3029-40 (2010). 20631256

Description
Gene SymbolMAGI2
Gene Full NameMembrane associated guanylate kinase, WW and PDZ domain containing 2
Alias SymbolsAIP1, AIP-1, ARIP1, SSCAM, MAGI-2, NPHS15, ACVRIP1
NCBI Gene Id9863
Protein NameMembrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
Description of TargetThe protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family.
Uniprot IDQ86UL8
Protein Accession #NP_036433
Nucleotide Accession #NM_012301
Protein Size (# AA)1455
Molecular Weight160kDa
Protein InteractionsBAI1; ARRDC3; CTNNB1; ADRB1; DSCAML1; PLXNB3; RAPGEF2; MAGI2; CTNND2; TGFA; GRID2; ATN1; DLL1; SMAD3; PTEN; ACVR2A;
  1. What is the species homology for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAGI2 Antibody - N-terminal region (ARP61404_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    This target may also be called "AIP1, AIP-1, ARIP1, SSCAM, MAGI-2, NPHS15, ACVRIP1" in publications.

  5. What is the shipping cost for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "160kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAGI2 Antibody - N-terminal region (ARP61404_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAGI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAGI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAGI2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAGI2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAGI2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAGI2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAGI2 Antibody - N-terminal region (ARP61404_P050)
Your Rating