Search Antibody, Protein, and ELISA Kit Solutions

MAGI2 antibody - N-terminal region (ARP61404_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61404_P050-FITC Conjugated

ARP61404_P050-HRP Conjugated

ARP61404_P050-Biotin Conjugated

Gene Symbol:
MAGI2
NCBI Gene Id:
9863
Official Gene Full Name:
Membrane associated guanylate kinase, WW and PDZ domain containing 2
Protein Name:
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
Swissprot Id:
Q86UL8
Protein Accession #:
NP_036433
Nucleotide Accession #:
NM_012301
Alias Symbols:
ACVRIP1, AIP1, ARIP1, MAGI-2, SSCAM, AIP-1
Replacement Item:
This antibody may replace item sc-11526 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family.
Protein Size (# AA):
1455
Molecular Weight:
160kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
ARP61404_P050
Peptide Sequence:
Synthetic peptide located within the following region: EEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAI1; ARRDC3; CTNNB1; ADRB1; DSCAML1; PLXNB3; RAPGEF2; MAGI2; CTNND2; TGFA; GRID2; ATN1; DLL1; SMAD3; PTEN; ACVR2A;
Blocking Peptide:
Catalog # AAP61404 (Previous Catalog # AAPP47522)
Datasheets/Manuals:
Printable datasheet for ARP61404_P050
Sample Type Confirmation:

MAGI2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Publications:

Doukhanine, E., Gavino, C., Haines, J. D., Almazan, G. & Richard, S. The QKI-6 RNA binding protein regulates actin-interacting protein-1 mRNA stability during oligodendrocyte differentiation. Mol. Biol. Cell 21, 3029-40 (2010). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20631256

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...