SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56340_P050
Price: $0.00
SKU
ARP56340_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MAGEB4 (ARP56340_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAGEB4 (ARP56340_P050) antibody is Catalog # AAP56340 (Previous Catalog # AAPP38406)
Sample Type Confirmation

MAGEB4 is supported by BioGPS gene expression data to be expressed in HepG2

Gene SymbolMAGEB4
Gene Full NameMelanoma antigen family B, 4
Alias SymbolsCT3.6
NCBI Gene Id4115
Protein NameMelanoma-associated antigen B4
Description of TargetThis gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.
Uniprot IDO15481
Protein Accession #NP_002358
Nucleotide Accession #NM_002367
Protein Size (# AA)346
Molecular Weight39kDa
Protein InteractionsWDR62; FERD3L; ZNF341; LZTS2; USHBP1; CCDC136; USP25; KANK2; RUNDC3A; MED21; HGS; KRT38; TNR; ROCK1; MAGEA8; UBC; FTSJ3;
  1. What is the species homology for "MAGEB4 Antibody - N-terminal region (ARP56340_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MAGEB4 Antibody - N-terminal region (ARP56340_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAGEB4 Antibody - N-terminal region (ARP56340_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAGEB4 Antibody - N-terminal region (ARP56340_P050)"?

    This target may also be called "CT3.6" in publications.

  5. What is the shipping cost for "MAGEB4 Antibody - N-terminal region (ARP56340_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAGEB4 Antibody - N-terminal region (ARP56340_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAGEB4 Antibody - N-terminal region (ARP56340_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAGEB4 Antibody - N-terminal region (ARP56340_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAGEB4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAGEB4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAGEB4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAGEB4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAGEB4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAGEB4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAGEB4 Antibody - N-terminal region (ARP56340_P050)
Your Rating