Search Antibody, Protein, and ELISA Kit Solutions

MAGEB10 Antibody - N-terminal region : FITC (ARP70822_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP70822_P050 Unconjugated

ARP70822_P050-HRP Conjugated

ARP70822_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MAGEB10
NCBI Gene Id:
139422
Swissprot Id:
Q96LZ2
Protein Accession #:
NP_872312
Alias Symbols:
MAGEB10,
Description of Target:
This gene encodes a member of the B subfamily of the melanoma associated antigen protein family. The encoded protein is specifically expressed in testis and tumor cells.
Protein Size (# AA):
347
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAGEB10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAGEB10.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAGEB10
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-MAGEB10 (ARP70822_P050-FITC) antibody is Catalog # AAP70822
Datasheets/Manuals:
Printable datasheet for anti-MAGEB10 (ARP70822_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...