MAGEA5 Antibody - N-terminal region (ARP46295_P050)

Catalog No: ARP46295_P050

WB Suggested Anti-MAGEA5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080 cell lysateMAGEA5 is supported by BioGPS gene expression data to be expressed in HT1080

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEA5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MAGEA5 (ARP46295_P050) antibody is Catalog # AAP46295 (Previous Catalog # AAPS17805)
• Sample Type Confirmation:

  MAGEA5 is supported by BioGPS gene expression data to be expressed in HT1080

Target Info

• Gene Symbol: MAGEA5
• Gene Full Name: Melanoma antigen family A, 5
• Alias Symbols: CT1.5, MAGE5, MAGEA4, MAGEA5
• NCBI Gene Id: 4104
• Protein Name: Melanoma-associated antigen 5
• Description of Target: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature.
• Uniprot ID: P43359
• Protein Accession #: NP_066387
• Nucleotide Accession #: NM_021049
• Protein Size (# AA): 124
• Molecular Weight: 13