$0.00
In Stock
SKU
OPCA311184
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

MAFF_RS22740 Recombinant Protein (Rhizobium loti) (OPCA311184)

Catalog#: OPCA311184
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Rhizobium loti
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence MSPQDRPSRTTEAFFGRRRGKPVRPQQAAALESGLDAYRLDLTADAPSDLRTLFETEVSAVRLEIGFGGGEHLLHRAIEAPTTGFIGVEPFVNGMAKMMMAVRARPLANLRVHDDDATRLLDWLPPASLGGIDLLYPDPWPKKKHWKRRFVSPVNLERFARVLKPGAKFRFASDIDTYVNWTLLHCRAHGAFAWQAAEAADWHRPYEGWPGTRYEAKAIREGRRPAYLTFVRK
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA311184
Gene Symbol MAFF_RS22740
NCBI Gene Id 1228854
Swissprot Id Q98BJ3
Protein Size (# AA) 233
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MAFF_RS22740.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MAFF_RS22740.
Write Your Own Review
You're reviewing:MAFF_RS22740 Recombinant Protein (Rhizobium loti) (OPCA311184)
Your Rating