SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP72516_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP72516_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-MAF (ARP72516_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human MAF
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: QLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEF
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAF (ARP72516_P050-FITC) antibody is Catalog # AAP72516
Gene SymbolMAF
Alias SymbolsCCA4, AYGRP, c-MAF, CTRCT21
NCBI Gene Id4094
Description of TargetThe protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDO75444
Protein Size (# AA)373
Molecular Weight41kDa
Protein InteractionsMAFB; FOSL1; MAF; FOS; ATF4; AHR; SUMO1; UBE2I; PML; SIN3A; HDAC2; SMARCA5; CEBPA; KDM5B; MAFA; SOX9; EP300; MAFG; USF2; CREBBP; MYB; JUN; ETS1; HOXD12;
  1. What is the species homology for "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)"?

    This target may also be called "CCA4, AYGRP, c-MAF, CTRCT21" in publications.

  5. What is the shipping cost for "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAF Antibody - C-terminal region : FITC (ARP72516_P050-FITC)
Your Rating
We found other products you might like!