MACROD1 Antibody - N-terminal region (ARP68610_P050)

Catalog No: ARP68610_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: MACROD1
Sample Type: Fetal Brain lysates
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: MACROD1
Positive control (+): Human kidney (KI)
Negative control (-): Human liver (LI)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MACROD1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MACROD1 (ARP68610_P050) antibody is Catalog # AAP68610

Target Info

• Gene Symbol: MACROD1
• Alias Symbols: LRP16
• NCBI Gene Id: 28992
• Protein Name: O-acetyl-ADP-ribose deacetylase MACROD1
• Description of Target: MACROD1 deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. It plays a role in estrogen signaling. Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen and may play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation. It could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction and could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells. MACROD1 enhances ESR1-mediated transcription activity.
• Uniprot ID: Q9BQ69
• Protein Accession #: NP_054786
• Nucleotide Accession #: NM_014067
• Protein Size (# AA): 325
• Molecular Weight: 36kDa
• Protein Interactions: BAG3; EPB41;