SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF07477 (Formerly GWB-ASB273)
Size:100 ug
Price: $344.00
SKU
OAAF07477
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLiquid PBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
ClonalityPolyclonal
IsotypeIgG
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:Y723 Mouse:Y721 Rat:Y721
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human M-CSF Receptor around the phosphorylation site of Tyr723.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: QDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQ
Concentration1 mg/ml
SpecificityM-CSF Receptor (Phospho-Tyr723) Antibody detects endogenous levels of M-CSF Receptor only when phosphorylated at Tyr723.
Application InfoWB: 1:500~1000
IHC: 1:50~100
ELISA: 1:5000
Gene SymbolCSF1R
Gene Full Namecolony stimulating factor 1 receptor
Alias SymbolsBANDDOS;CD115;CD115 antigen;C-FMS;CSF-1 receptor;CSF-1R;CSFR;FIM2;FMS;FMS proto-oncogene;HDLS;macrophage colony stimulating factor I receptor;macrophage colony-stimulating factor 1 receptor;McDonough feline sarcoma viral (v-fms) oncogene homolog;M-CSF-R;proto-oncogene c-Fms.
NCBI Gene Id1436
Protein NameMacrophage colony-stimulating factor 1 receptor
Description of TargetTyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor.
Uniprot IDP07333
Molecular Weight107 kDa
  1. What is the species homology for "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)" provided in?

    This item is provided in "Liquid PBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol ".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)"?

    This target may also be called "BANDDOS;CD115;CD115 antigen;C-FMS;CSF-1 receptor;CSF-1R;CSFR;FIM2;FMS;FMS proto-oncogene;HDLS;macrophage colony stimulating factor I receptor;macrophage colony-stimulating factor 1 receptor;McDonough feline sarcoma viral (v-fms) oncogene homolog;M-CSF-R;proto-oncogene c-Fms." in publications.

  5. What is the shipping cost for "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "107 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CSF1R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CSF1R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CSF1R"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CSF1R"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CSF1R"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CSF1R"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:M-CSF Receptor Antibody (Phospho-Tyr723) (OAAF07477)
Your Rating
We found other products you might like!