Search Antibody, Protein, and ELISA Kit Solutions

LZTS1 Antibody - N-terminal region : FITC (ARP72909_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72909_P050 Unconjugated

ARP72909_P050-HRP Conjugated

ARP72909_P050-Biotin Conjugated

Gene Symbol:
LZTS1
NCBI Gene Id:
11178
Swissprot Id:
Q9Y250
Protein Accession #:
XP_005273451
Alias Symbols:
LZTS1, FEZ1,
Replacement Item:
This antibody may replace item sc-135904 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing or nonmetastasizing tumor cells. This protein may have a role in cell-cycle control by interacting with the Cdk1/cyclinB1 complex. This gene is located on chromosomal region 8p22. Loss of heterozygosity (LOH) in the 8p arm is a common characteristic of many types of cancer.
Protein Size (# AA):
596
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LZTS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LZTS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 100%
Peptide Sequence:
Synthetic peptide located within the following region: LKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
EEF1G; CDC25C; CDK1;
Blocking Peptide:
For anti-LZTS1 (ARP72909_P050-FITC) antibody is Catalog # AAP72909
Datasheets/Manuals:
Printable datasheet for anti-LZTS1 (ARP72909_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...