Search Antibody, Protein, and ELISA Kit Solutions

LZTS1 Antibody - N-terminal region (ARP72909_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72909_P050-FITC Conjugated

ARP72909_P050-HRP Conjugated

ARP72909_P050-Biotin Conjugated

Gene Symbol:
LZTS1
NCBI Gene Id:
11178
Swissprot Id:
Q9Y250
Protein Accession #:
XP_005273451
Alias Symbols:
LZTS1, FEZ1,
Replacement Item:
This antibody may replace item sc-135904 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing or nonmetastasizing tumor cells. This protein may have a role in cell-cycle control by interacting with the Cdk1/cyclinB1 complex. This gene is located on chromosomal region 8p22. Loss of heterozygosity (LOH) in the 8p arm is a common characteristic of many types of cancer.
Protein Size (# AA):
596
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LZTS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LZTS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 100%
Peptide Sequence:
Synthetic peptide located within the following region: LKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EEF1G; CDC25C; CDK1;
Blocking Peptide:
For anti-LZTS1 (ARP72909_P050) antibody is Catalog # AAP72909
Datasheets/Manuals:
Printable datasheet for anti-LZTS1 (ARP72909_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...