Search Antibody, Protein, and ELISA Kit Solutions

LYZ Antibody - N-terminal region (ARP60298_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60298_P050-FITC Conjugated

ARP60298_P050-HRP Conjugated

ARP60298_P050-Biotin Conjugated

Gene Symbol:
LYZ
Official Gene Full Name:
Lysozyme
NCBI Gene Id:
4069
Protein Name:
Lysozyme C
Swissprot Id:
P61626
Protein Accession #:
NP_000230
Nucleotide Accession #:
NM_000239
Alias Symbols:
LZM, lysozyme
Replacement Item:
This antibody may replace item sc-27956 from Santa Cruz Biotechnology.
Description of Target:
LYZ is a human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
Protein Size (# AA):
148
Molecular Weight:
15kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LYZ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LYZ.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LYZ
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Goat: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Sheep: 93%
Complete computational species homology data:
Anti-LYZ (ARP60298_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TP53; FUS; NEDD1; CEP57; AURKA; STAU1; SMAD6; UBC; GRK5; CRK; CLU; COPS6; CUL4B; CDK2; PARP11; USP25; USP1; LCN1; LTF; ELN; A2M; LRRK1; NME2; KHK;
Blocking Peptide:
For anti-LYZ (ARP60298_P050) antibody is Catalog # AAP60298 (Previous Catalog # AAPP46479)
Datasheets/Manuals:
Printable datasheet for anti-LYZ (ARP60298_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...