Catalog No: ARP60297_P050
Price: $0.00
SKU
ARP60297_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LYZ (ARP60297_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human LYZ
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Guinea Pig: 77%; Horse: 77%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG
Concentration0.5 mg/ml
Blocking PeptideFor anti-LYZ (ARP60297_P050) antibody is Catalog # AAP60297 (Previous Catalog # AAPP46593)
Gene SymbolLYZ
Gene Full NameLysozyme
Alias SymbolsLZM, LYZF1
NCBI Gene Id4069
Protein NameLysozyme C
Description of TargetLYZ is a human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
Uniprot IDP61626
Protein Accession #NP_000230
Nucleotide Accession #NM_000239
Protein Size (# AA)148
Molecular Weight15kDa
Protein InteractionsTP53; FUS; NEDD1; CEP57; AURKA; STAU1; SMAD6; UBC; GRK5; CRK; CLU; COPS6; CUL4B; CDK2; PARP11; USP25; USP1; LCN1; LTF; ELN; A2M; LRRK1; NME2; KHK;
  1. What is the species homology for "LYZ Antibody - C-terminal region (ARP60297_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Guinea Pig, Horse".

  2. How long will it take to receive "LYZ Antibody - C-terminal region (ARP60297_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LYZ Antibody - C-terminal region (ARP60297_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LYZ Antibody - C-terminal region (ARP60297_P050)"?

    This target may also be called "LZM, LYZF1" in publications.

  5. What is the shipping cost for "LYZ Antibody - C-terminal region (ARP60297_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LYZ Antibody - C-terminal region (ARP60297_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LYZ Antibody - C-terminal region (ARP60297_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LYZ Antibody - C-terminal region (ARP60297_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LYZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LYZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LYZ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LYZ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LYZ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LYZ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LYZ Antibody - C-terminal region (ARP60297_P050)
Your Rating
We found other products you might like!