Search Antibody, Protein, and ELISA Kit Solutions

LYPLA2 Antibody - N-terminal region (ARP58638_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP58638_P050-FITC Conjugated

ARP58638_P050-HRP Conjugated

ARP58638_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-112779 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-LYPLA2 (ARP58638_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-LYPLA2 (ARP58638_P050) antibody is Catalog # AAP58638 (Previous Catalog # AAPP35775)
Datasheets/Manuals:
Printable datasheet for anti-LYPLA2 (ARP58638_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that LYPLA2 is expressed in HEK293T

Target Reference:
Ma,J., (2007) Atherosclerosis 191 (1), 63-72
Gene Symbol:
LYPLA2
Official Gene Full Name:
Lysophospholipase II
Alias Symbols:
APT-2, DJ886K2.4
NCBI Gene Id:
11313
Protein Name:
Acyl-protein thioesterase 2
Description of Target:
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Swissprot Id:
O95372
Protein Accession #:
NP_009191
Nucleotide Accession #:
NM_007260
Protein Size (# AA):
231
Molecular Weight:
25kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LYPLA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LYPLA2.
Protein Interactions:
UBC; VCAM1; ITGA4; APP; MED31; SCMH1; DKC1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...