Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

LYPLA2 Antibody - N-terminal region (ARP58638_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58638_P050-FITC Conjugated

ARP58638_P050-HRP Conjugated

ARP58638_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Lysophospholipase II
NCBI Gene Id:
Protein Name:
Acyl-protein thioesterase 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
APT-2, DJ886K2.4
Replacement Item:
This antibody may replace item sc-112779 from Santa Cruz Biotechnology.
Description of Target:
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LYPLA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LYPLA2.
The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-LYPLA2 (ARP58638_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LYPLA2 (ARP58638_P050) antibody is Catalog # AAP58638 (Previous Catalog # AAPP35775)
Printable datasheet for anti-LYPLA2 (ARP58638_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that LYPLA2 is expressed in HEK293T

Target Reference:
Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...