LYPLA1 Antibody - middle region (ARP52148_P050)

Catalog No: ARP52148_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-LYPLA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: CCRF-CEM cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYPLA1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LYPLA1 (ARP52148_P050) antibody is Catalog # AAP52148 (Previous Catalog # AAPP40374)

Target Info

• Reference: Devedjiev,Y., (2000) Structure 8 (11), 1137-1146
• Gene Symbol: LYPLA1
• Gene Full Name: Lysophospholipase I
• Alias Symbols: APT1, LPL1, APT-1, LPL-I, hAPT1
• NCBI Gene Id: 10434
• Protein Name: Acyl-protein thioesterase 1
• Description of Target: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
• Uniprot ID: O75608
• Protein Accession #: NP_006321
• Nucleotide Accession #: NM_006330
• Protein Size (# AA): 230
• Molecular Weight: 25kDa
• Protein Interactions: GOLGA2; UBC; VCAM1; ITGA4; FN1; ELAVL1; LYPLA1; ANXA2;