Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53451_P050-FITC Conjugated

ARP53451_P050-HRP Conjugated

ARP53451_P050-Biotin Conjugated

LYPD6 Antibody - middle region (ARP53451_P050)

Catalog#: ARP53451_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-137591 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LYPD6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-LYPD6 (ARP53451_P050)
Peptide SequenceSynthetic peptide located within the following region: RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-LYPD6 (ARP53451_P050) antibody is Catalog # AAP53451 (Previous Catalog # AAPP31974)
Datasheets/ManualsPrintable datasheet for anti-LYPD6 (ARP53451_P050) antibody
Target ReferenceZhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Arvaniti, M; Jensen, MM; Soni, N; Wang, H; Klein, AB; Thiriet, N; Pinborg, LH; Muldoon, PP; Wienecke, J; Imad Damaj, M; Kohlmeier, KA; Gondré-Lewis, MC; Mikkelsen, JD; Thomsen, MS; Functional interaction between Lypd6 and nicotinic acetylcholine receptors. 138, 806-20 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27344019

Gene SymbolLYPD6
Official Gene Full NameLY6/PLAUR domain containing 6
Alias SymbolsMGC52057
NCBI Gene Id130574
Protein NameLy6/PLAUR domain-containing protein 6
Description of TargetLYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.
Swissprot IdQ86Y78
Protein Accession #NP_919298
Nucleotide Accession #NM_194317
Protein Size (# AA)171
Molecular Weight19kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express LYPD6.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express LYPD6.
  1. What is the species homology for "LYPD6 Antibody - middle region (ARP53451_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "LYPD6 Antibody - middle region (ARP53451_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LYPD6 Antibody - middle region (ARP53451_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "LYPD6 Antibody - middle region (ARP53451_P050)"?

    This target may also be called "MGC52057" in publications.

  5. What is the shipping cost for "LYPD6 Antibody - middle region (ARP53451_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LYPD6 Antibody - middle region (ARP53451_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "LYPD6 Antibody - middle region (ARP53451_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LYPD6 Antibody - middle region (ARP53451_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LYPD6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LYPD6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LYPD6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LYPD6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LYPD6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LYPD6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LYPD6 Antibody - middle region (ARP53451_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Tips and Tricks
Free Microscope
Aviva Tissue Tool