Search Antibody, Protein, and ELISA Kit Solutions

LYPD6 antibody - middle region (ARP53451_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53451_P050-FITC Conjugated

ARP53451_P050-HRP Conjugated

ARP53451_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
LY6/PLAUR domain containing 6
Protein Name:
Ly6/PLAUR domain-containing protein 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-137591 from Santa Cruz Biotechnology.
Description of Target:
LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LYPD6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LYPD6.
The immunogen is a synthetic peptide directed towards the middle region of human LYPD6
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-LYPD6 (ARP53451_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-LYPD6 (ARP53451_P050) antibody is Catalog # AAP53451 (Previous Catalog # AAPP31974)
Printable datasheet for anti-LYPD6 (ARP53451_P050) antibody
Target Reference:
Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Arvaniti, M; Jensen, MM; Soni, N; Wang, H; Klein, AB; Thiriet, N; Pinborg, LH; Muldoon, PP; Wienecke, J; Imad Damaj, M; Kohlmeier, KA; Gondré-Lewis, MC; Mikkelsen, JD; Thomsen, MS; Functional interaction between Lypd6 and nicotinic acetylcholine receptors. 138, 806-20 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27344019

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...