Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LYL1 Antibody : HRP (ARP30931_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock

Conjugation Options

ARP30931_P050 Unconjugated

ARP30931_P050-FITC Conjugated

ARP30931_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
LYL1
NCBI Gene Id:
4066
Official Gene Full Name:
lymphoblastic leukemia derived sequence 1
Protein Name:
Protein lyl-1
Swissprot Id:
P12980
Protein Accession #:
NP_005574
Nucleotide Accession #:
NM_005583
Alias Symbols:
bHLHa18,
Description of Target:
This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia.
Protein Size (# AA):
280
Molecular Weight:
30 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LYL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LYL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence GPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
Species Reactivity:
Human, Pig
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%
Complete computational species homology data:
Anti-LYL1 (ARP30931_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.6-0.7 mg/ml
Protein Interactions:
TAL1; TRIM33; DRG1; LMO1; LMO2; NFKB1; TCF3; NFKBIA; TCF4;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-LYL1 (ARP30931_P050-HRP) antibody
Conjugation:
HRP

Tell us what you think about this item!

Write A Review
    Please, wait...