SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62393_P050
Price: $0.00
SKU
ARP62393_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LY6G5B (ARP62393_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Horse: 79%; Human: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: IYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSS
Concentration0.5 mg/ml
Blocking PeptideFor anti-LY6G5B (ARP62393_P050) antibody is Catalog # AAP62393
Gene SymbolLY6G5B
Gene Full NameLymphocyte antigen 6 complex, locus G5B
Alias SymbolsG5b, C6orf19
NCBI Gene Id58496
Protein NameLymphocyte antigen 6 complex locus protein G5b
Description of TargetLY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction.
Uniprot IDQ8NDX9
Protein Accession #NP_067044
Nucleotide Accession #NM_021221
Protein Size (# AA)201
Molecular Weight22kDa
Protein InteractionsNEDD1; TUBGCP3; CEP57; TP53; VCAM1; FN1; UBC;
  1. What is the species homology for "LY6G5B Antibody - N-terminal region (ARP62393_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Horse, Pig".

  2. How long will it take to receive "LY6G5B Antibody - N-terminal region (ARP62393_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LY6G5B Antibody - N-terminal region (ARP62393_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LY6G5B Antibody - N-terminal region (ARP62393_P050)"?

    This target may also be called "G5b, C6orf19" in publications.

  5. What is the shipping cost for "LY6G5B Antibody - N-terminal region (ARP62393_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LY6G5B Antibody - N-terminal region (ARP62393_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LY6G5B Antibody - N-terminal region (ARP62393_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LY6G5B Antibody - N-terminal region (ARP62393_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LY6G5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LY6G5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LY6G5B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LY6G5B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LY6G5B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LY6G5B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LY6G5B Antibody - N-terminal region (ARP62393_P050)
Your Rating