LUM Recombinant Protein (Rat) (OPCA03676)

Catalog No: OPCA03676

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Host: Rat
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
• Protein Sequence: QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 19-338 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project TeamGenome Res. 14:2121-2127(2004)
• Gene Symbol: Lum
• Gene Full Name: lumican
• Alias Symbols: keratan sulfate proteoglycan lumican;KSPG lumican;lumican.
• NCBI Gene Id: 81682
• Protein Name: Lumican
• Description of Target: member of leucine-rich proteoglycan family; may play a role in immature and transient fibrosis of acute pancreatitis [RGD, Feb 2006]
• Uniprot ID: P51886
• Protein Accession #: NP_112312.1
  
• Nucleotide Accession #: NM_031050.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 40.5 kDa