Size:100 ul
$229.00
In Stock
SKU
ARP49035_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49035_T100-FITC Conjugated

ARP49035_T100-HRP Conjugated

ARP49035_T100-Biotin Conjugated

LTC4S Antibody - N-terminal region (ARP49035_T100)

Catalog#: ARP49035_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-22564-R from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85%
Complete computational species homology data Anti-LTC4S (leukotriene C4 synthase) (against the N terminal of LTC4S) (100ug)
Peptide Sequence Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LTC4S (ARP49035_T100) antibody is Catalog # AAP49035 (Previous Catalog # AAPY02192)
Datasheets/Manuals Printable datasheet for anti-LTC4S (ARP49035_T100) antibody
Target Reference Freiberg,J.J., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (5), 990-996
Publications

Tang, F; Sally, B; Lesko, K; Discepolo, V; Abadie, V; Ciszewski, C; Semrad, C; Guandalini, S; Kupfer, SS; Jabri, B; Cysteinyl leukotrienes mediate lymphokine killer activity induced by NKG2D and IL-15 in cytotoxic T cells during celiac disease. 212, 1487-95 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26304964

Gene Symbol LTC4S
Official Gene Full Name Leukotriene C4 synthase
Alias Symbols MGC33147
NCBI Gene Id 4056
Protein Name Leukotriene C4 synthase
Description of Target The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q16873
Protein Accession # NP_665874
Nucleotide Accession # NM_145867
Protein Size (# AA) 150
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LTC4S.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LTC4S.
Protein Interactions MGST1; LTC4S; ALOX5AP; ALOX5;
  1. What is the species homology for "LTC4S Antibody - N-terminal region (ARP49035_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "LTC4S Antibody - N-terminal region (ARP49035_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LTC4S Antibody - N-terminal region (ARP49035_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LTC4S Antibody - N-terminal region (ARP49035_T100)"?

    This target may also be called "MGC33147" in publications.

  5. What is the shipping cost for "LTC4S Antibody - N-terminal region (ARP49035_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LTC4S Antibody - N-terminal region (ARP49035_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LTC4S Antibody - N-terminal region (ARP49035_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LTC4S Antibody - N-terminal region (ARP49035_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LTC4S"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LTC4S"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LTC4S"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LTC4S"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LTC4S"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LTC4S"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LTC4S Antibody - N-terminal region (ARP49035_T100)
Your Rating
We found other products you might like!