- Gene Symbol:
- LTC4S
- NCBI Gene Id:
- 4056
- Official Gene Full Name:
- Leukotriene C4 synthase
- Protein Name:
- Leukotriene C4 synthase
- Swissprot Id:
- Q16873
- Protein Accession #:
- NP_665874
- Nucleotide Accession #:
- NM_145867
- Alias Symbols:
- MGC33147
- Replacement Item:
- This antibody may replace item sc-22564-R from Santa Cruz Biotechnology.
- Description of Target:
- The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Protein Size (# AA):
- 150
- Molecular Weight:
- 16kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Protein A purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express LTC4S.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express LTC4S.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85%
- Complete computational species homology data:
- Anti-LTC4S (leukotriene C4 synthase) (against the N terminal of LTC4S) (100ug)
- Peptide Sequence:
- Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- MGST1; LTC4S; ALOX5AP; ALOX5;
- Blocking Peptide:
- For anti-LTC4S (ARP49035_T100) antibody is Catalog # AAP49035 (Previous Catalog # AAPY02192)
- Datasheets/Manuals:
- Printable datasheet for anti-LTC4S (ARP49035_T100) antibody
- Target Reference:
- Freiberg,J.J., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (5), 990-996
- Publications:
Tang, F; Sally, B; Lesko, K; Discepolo, V; Abadie, V; Ciszewski, C; Semrad, C; Guandalini, S; Kupfer, SS; Jabri, B; Cysteinyl leukotrienes mediate lymphokine killer activity induced by NKG2D and IL-15 in cytotoxic T cells during celiac disease. 212, 1487-95 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26304964
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
