Size:100 ul
$229.00
In stock
SKU
ARP49035_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49035_T100-FITC Conjugated

ARP49035_T100-HRP Conjugated

ARP49035_T100-Biotin Conjugated

LTC4S Antibody - N-terminal region (ARP49035_T100)

Catalog#: ARP49035_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-22564-R from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85%
Complete computational species homology dataAnti-LTC4S (leukotriene C4 synthase) (against the N terminal of LTC4S) (100ug)
Peptide SequenceSynthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-LTC4S (ARP49035_T100) antibody is Catalog # AAP49035 (Previous Catalog # AAPY02192)
Datasheets/ManualsPrintable datasheet for anti-LTC4S (ARP49035_T100) antibody
Target ReferenceFreiberg,J.J., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (5), 990-996
Publications

Tang, F; Sally, B; Lesko, K; Discepolo, V; Abadie, V; Ciszewski, C; Semrad, C; Guandalini, S; Kupfer, SS; Jabri, B; Cysteinyl leukotrienes mediate lymphokine killer activity induced by NKG2D and IL-15 in cytotoxic T cells during celiac disease. 212, 1487-95 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26304964

Gene SymbolLTC4S
Official Gene Full NameLeukotriene C4 synthase
Alias SymbolsMGC33147
NCBI Gene Id4056
Protein NameLeukotriene C4 synthase
Description of TargetThe MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdQ16873
Protein Accession #NP_665874
Nucleotide Accession #NM_145867
Protein Size (# AA)150
Molecular Weight16kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express LTC4S.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express LTC4S.
Protein InteractionsMGST1; LTC4S; ALOX5AP; ALOX5;
Write Your Own Review
You're reviewing:LTC4S Antibody - N-terminal region (ARP49035_T100)
Your Rating
Aviva Validation Data
Aviva Blast Tool
Aviva Live Chat
Free Microscope