Search Antibody, Protein, and ELISA Kit Solutions

LTC4S Antibody - N-terminal region (ARP49035_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49035_T100-FITC Conjugated

ARP49035_T100-HRP Conjugated

ARP49035_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
LTC4S
Official Gene Full Name:
Leukotriene C4 synthase
NCBI Gene Id:
4056
Protein Name:
Leukotriene C4 synthase
Swissprot Id:
Q16873
Protein Accession #:
NP_665874
Nucleotide Accession #:
NM_145867
Alias Symbols:
MGC33147
Replacement Item:
This antibody may replace item sc-22564-R from Santa Cruz Biotechnology.
Description of Target:
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
150
Molecular Weight:
16kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LTC4S.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LTC4S.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85%
Peptide Sequence:
Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MGST1; LTC4S; ALOX5AP; ALOX5;
Blocking Peptide:
For anti-LTC4S (ARP49035_T100) antibody is Catalog # AAP49035 (Previous Catalog # AAPY02192)
Datasheets/Manuals:
Printable datasheet for anti-LTC4S (ARP49035_T100) antibody
Target Reference:
Freiberg,J.J., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (5), 990-996
Publications:

Tang, F; Sally, B; Lesko, K; Discepolo, V; Abadie, V; Ciszewski, C; Semrad, C; Guandalini, S; Kupfer, SS; Jabri, B; Cysteinyl leukotrienes mediate lymphokine killer activity induced by NKG2D and IL-15 in cytotoxic T cells during celiac disease. 212, 1487-95 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26304964

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...