Search Antibody, Protein, and ELISA Kit Solutions

LTC4S Antibody - N-terminal region (ARP49035_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49035_T100-FITC Conjugated

ARP49035_T100-HRP Conjugated

ARP49035_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-22564-R from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85%
Peptide Sequence:
Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-LTC4S (ARP49035_T100) antibody is Catalog # AAP49035 (Previous Catalog # AAPY02192)
Printable datasheet for anti-LTC4S (ARP49035_T100) antibody
Target Reference:
Freiberg,J.J., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (5), 990-996

Tang, F; Sally, B; Lesko, K; Discepolo, V; Abadie, V; Ciszewski, C; Semrad, C; Guandalini, S; Kupfer, SS; Jabri, B; Cysteinyl leukotrienes mediate lymphokine killer activity induced by NKG2D and IL-15 in cytotoxic T cells during celiac disease. 212, 1487-95 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26304964

Gene Symbol:
Official Gene Full Name:
Leukotriene C4 synthase
Alias Symbols:
NCBI Gene Id:
Protein Name:
Leukotriene C4 synthase
Description of Target:
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LTC4S.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LTC4S.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...