LTC4S Antibody - N-terminal region (ARP49035_P050)

Catalog No: ARP49035_P050

WB Suggested Anti-LTC4S Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LTC4S (ARP49035_P050) antibody is Catalog # AAP49035

Target Info

• Gene Symbol: LTC4S
• Gene Full Name: Leukotriene C4 synthase
• Alias Symbols: MGC33147
• NCBI Gene Id: 4056
• Protein Name: Leukotriene C4 synthase
• Description of Target: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.
• Uniprot ID: Q16873
• Protein Accession #: NP_665874
• Nucleotide Accession #: NM_145867
• Protein Size (# AA): 150
• Molecular Weight: 16kDa
• Protein Interactions: MGST1; LTC4S; ALOX5AP; ALOX5;