LTB Recombinant Protein (Chimpanzee) (OPCA04019)

Catalog No: OPCA04019

Product Info

• Predicted Species Reactivity: Chimpanzee|Pan troglodytes
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Pan troglodytes (Chimpanzee)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
• Protein Sequence: QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 49-244 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M., Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K., Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A. , Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T., Inoko H., Bahram S.Genetics 173:1555-1570(2006)
• Gene Symbol: LTB
• Gene Full Name: lymphotoxin beta
• Alias Symbols: CK820_G0006843;LT-beta;lymphotoxin beta (TNF superfamily, member 3);lymphotoxin-beta;TNF-C;tumor necrosis factor C;tumor necrosis factor ligand superfamily member 3.
• NCBI Gene Id: 744486
• Protein Name: Lymphotoxin-beta
• Description of Target: Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface (By similarity).
• Uniprot ID: Q862Z7
• Protein Accession #: NP_001070252
• Nucleotide Accession #: NM_001076784
• Protein Size (# AA): Recombinant
• Molecular Weight: 24.8 kDa