LTA4H Antibody - middle region (ARP54368_P050)

Catalog No: ARP54368_P050

WB Suggested Anti-LTA4H Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysateLTA4H is supported by BioGPS gene expression data to be expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LTA4H
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LTA4H (ARP54368_P050) antibody is Catalog # AAP54368 (Previous Catalog # AAPP31143)
• Sample Type Confirmation:

  LTA4H is supported by BioGPS gene expression data to be expressed in HEK293T

• Reference: Bevan,S., (2008) Stroke 39 (4), 1109-1114

Target Info

• Gene Symbol: LTA4H
• Gene Full Name: Leukotriene A4 hydrolase
• Alias Symbols: -
• NCBI Gene Id: 4048
• Protein Name: Leukotriene A-4 hydrolase
• Description of Target: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.
• Uniprot ID: P09960
• Protein Accession #: NP_000886
• Nucleotide Accession #: NM_000895
• Protein Size (# AA): 611
• Molecular Weight: 69kDa
• Protein Interactions: UBC; ZNF593; SIRT1; TINF2; SIRT7; ELAVL1; HDAC5; UBA5; DDA1; ARPC3; TMEM62; MCC; GH1;