Protein on Demand™ LSM1 Recombinant Protein (Human) (OPCA24117)

Datasheets/Manuals	Printable datasheet for OPCA24117

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-133

Gene Full Name	LSM1 homolog, mRNA degradation associated
Alias Symbols	CASM, YJL124C
NCBI Gene Id	27257
Protein Name	U6 snRNA-associated Sm-like protein LSm1
Description of Target	This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation
Uniprot ID	O15116
Protein Accession #	NP_055277.1
Nucleotide Accession #	NM_014462.2
Protein Size (# AA)	133