LSM1 Antibody (OAAL00644)

Catalog No: OAAL00644

Size:100UG

Detection limit for recombinant GST tagged LSM1 is 0.3 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 4F7
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: LSM1 (NP_055277.1, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: SIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: LSM1
• Gene Full Name: LSM1 homolog, mRNA degradation associated
• Alias Symbols: cancer-associated Sm protein;cancer-associated Sm-like protein;CASM;LSM1 homolog, U6 small nuclear RNA associated;LSM1 mRNA degradation associated;LSM1, U6 small nuclear RNA associated;LSM1-like protein U6 small nuclear RNA associated;small nuclear ribonuclear CaSm;U6 snRNA-associated Sm-like protein LSm1;YJL124C.
• NCBI Gene Id: 27257
• Protein Name: Homo sapiens LSM1 homolog, mRNA degradation associated (LSM1), transcript variant 1, mRNA|U6 snRNA-associated Sm-like protein LSm1 [Homo sapiens]
• Description of Target: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_055277.1
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_014462