LSAMP Antibody - N-terminal region (ARP45277_P050)

Catalog No: ARP45277_P050

WB Suggested Anti-LSAMP Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LSAMP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LSAMP (ARP45277_P050) antibody is Catalog # AAP45277 (Previous Catalog # AAPP26259)
• Reference: Pimenta,A.F., (1998) Genomics 49 (3), 472-474

Target Info

• Gene Symbol: LSAMP
• Gene Full Name: Limbic system-associated membrane protein
• Alias Symbols: LAMP, IGLON3
• NCBI Gene Id: 4045
• Protein Name: Limbic system-associated membrane protein
• Description of Target: LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.
• Uniprot ID: Q13449
• Protein Accession #: NP_002329
• Nucleotide Accession #: NM_002338
• Protein Size (# AA): 338
• Molecular Weight: 37kDa
• Protein Interactions: LSAMP; NEGR1; NTM; Htt; PRNP;