Search Antibody, Protein, and ELISA Kit Solutions

LRSAM1 Antibody - N-terminal region (ARP73333_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73333_P050-FITC Conjugated

ARP73333_P050-HRP Conjugated

ARP73333_P050-Biotin Conjugated

Gene Symbol:
LRSAM1
NCBI Gene Id:
90678
Swissprot Id:
Q6UWE0
Protein Accession #:
NP_612370
Alias Symbols:
LRSAM1, TAL, UNQ6496/PRO21356,
Replacement Item:
This antibody may replace item sc-139529 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a ring finger protein involved in a variety of functions, including regulation of signaling pathways and cell adhesion, mediation of self-ubiquitylation, and involvement in cargo sorting during receptor endocytosis. Mutations in this gene have been associated with Charcot-Marie-Tooth disease. Multiple transcript variants encoding different isoforms have been identified for this gene.
Protein Size (# AA):
723
Molecular Weight:
79kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRSAM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRSAM1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRSAM1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LRSAM1; UBC; TSG101; P3H1; GOPC; ANKMY2; CTPS2; PPME1; EHD4; ERO1L; DBNL; HSPBP1; PLIN3; MTMR2; UBE3A; HSF1; DR1; DDX5; CBS; HSP90AA1; USP21; USP2; YTHDF1; TRIM74; VPS11; RNF111; TRIM17; MKRN3; ATXN1; MDM4; TERF1; ATXN7; UEVLD; UBE2W; UBE2D4; UBE2J1; UBE2
Blocking Peptide:
For anti-LRSAM1 (ARP73333_P050) antibody is Catalog # AAP73333
Datasheets/Manuals:
Printable datasheet for anti-LRSAM1 (ARP73333_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...