Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

LRRTM3 Antibody - middle region : FITC (ARP65921_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP65921_P050 Unconjugated

ARP65921_P050-HRP Conjugated

ARP65921_P050-Biotin Conjugated

Gene Symbol:
LRRTM3
NCBI Gene Id:
347731
Swissprot Id:
Q86VH5-2
Alias Symbols:
LRRTM3, UNQ803/PRO1693,
Replacement Item:
This antibody may replace item sc-133384 from Santa Cruz Biotechnology.
Description of Target:
LRRTM3 exhibits a limited synaptogenic activity in vitro, restricted to excitatory presynaptic differentiation. It may play a role in the development and maintenance of the vertebrate nervous system.
Protein Size (# AA):
513
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRRTM3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRRTM3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human LRRTM3
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-LRRTM3 (ARP65921_P050-FITC) antibody is Catalog # AAP65921
Datasheets/Manuals:
Printable datasheet for anti-LRRTM3 (ARP65921_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...