Search Antibody, Protein, and ELISA Kit Solutions

LRRC50 antibody - N-terminal region (ARP53358_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53358_P050-FITC Conjugated

ARP53358_P050-HRP Conjugated

ARP53358_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Dynein, axonemal, assembly factor 1
Protein Name:
Dynein assembly factor 1, axonemal
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp434A119, FLJ25330, ODA7, CILD13, LRRC50
Description of Target:
LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRRC50.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRRC50.
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-LRRC50 (ARP53358_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DNAAF1 (ARP53358_P050) antibody is Catalog # AAP53358 (Previous Catalog # AAPP30941)
Printable datasheet for anti-DNAAF1 (ARP53358_P050) antibody
Sample Type Confirmation:

DNAAF1 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Kimura,K., (2006) Genome Res. 16 (1), 55-65

Yang, L. et al. Knockdown of PPAR δ gene promotes the growth of colon cancer and reduces the sensitivity to bevacizumab in nude mice model. PLoS One 8, e60715 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 23593291

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...