Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP53358_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53358_P050-FITC Conjugated

ARP53358_P050-HRP Conjugated

ARP53358_P050-Biotin Conjugated

LRRC50 Antibody - N-terminal region (ARP53358_P050)

Catalog#: ARP53358_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-LRRC50 (ARP53358_P050)
Peptide Sequence Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DNAAF1 (ARP53358_P050) antibody is Catalog # AAP53358 (Previous Catalog # AAPP30941)
Datasheets/Manuals Printable datasheet for anti-DNAAF1 (ARP53358_P050) antibody
Sample Type Confirmation

DNAAF1 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Publications

Yang, L. et al. Knockdown of PPAR δ gene promotes the growth of colon cancer and reduces the sensitivity to bevacizumab in nude mice model. PLoS One 8, e60715 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 23593291

Gene Symbol DNAAF1
Official Gene Full Name Dynein, axonemal, assembly factor 1
Alias Symbols DKFZp434A119, FLJ25330, ODA7, CILD13, LRRC50
NCBI Gene Id 123872
Protein Name Dynein assembly factor 1, axonemal
Description of Target LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
Swissprot Id Q8NEP3
Protein Accession # NP_848547
Nucleotide Accession # NM_178452
Protein Size (# AA) 725
Molecular Weight 80kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LRRC50.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LRRC50.
Protein Interactions UBC;
  1. What is the species homology for "LRRC50 Antibody - N-terminal region (ARP53358_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "LRRC50 Antibody - N-terminal region (ARP53358_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LRRC50 Antibody - N-terminal region (ARP53358_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LRRC50 Antibody - N-terminal region (ARP53358_P050)"?

    This target may also be called "DKFZp434A119, FLJ25330, ODA7, CILD13, LRRC50" in publications.

  5. What is the shipping cost for "LRRC50 Antibody - N-terminal region (ARP53358_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LRRC50 Antibody - N-terminal region (ARP53358_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LRRC50 Antibody - N-terminal region (ARP53358_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "80kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LRRC50 Antibody - N-terminal region (ARP53358_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DNAAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DNAAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DNAAF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DNAAF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DNAAF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DNAAF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LRRC50 Antibody - N-terminal region (ARP53358_P050)
Your Rating
We found other products you might like!