Size:100 ul
$289.00
In Stock
SKU
ARP49593_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49593_P050 Unconjugated

ARP49593_P050-HRP Conjugated

ARP49593_P050-Biotin Conjugated

LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)

Catalog#: ARP49593_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-51377 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-LRRC4C (ARP49593_P050)
Peptide Sequence Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Concentration 0.5 mg/ml
Blocking Peptide For anti-LRRC4C (ARP49593_P050-FITC) antibody is Catalog # AAP49593 (Previous Catalog # AAPP29442)
Datasheets/Manuals Printable datasheet for anti-LRRC4C (ARP49593_P050-FITC) antibody
Target Reference Lin,J.C., (2003) Nat. Neurosci. 6 (12), 1270-1276
Gene Symbol LRRC4C
Official Gene Full Name Leucine rich repeat containing 4C
Alias Symbols KIAA1580, NGL-1, NGL1
NCBI Gene Id 57689
Protein Name Leucine-rich repeat-containing protein 4C
Description of Target NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055
Swissprot Id Q9HCJ2
Protein Accession # NP_065980
Nucleotide Accession # NM_020929
Protein Size (# AA) 640
Molecular Weight 72kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LRRC4C.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LRRC4C.
Protein Interactions CREB3L4; NTNG1; LRRC4C; DFNB31;
  1. What is the species homology for "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)"?

    This target may also be called "KIAA1580, NGL-1, NGL1" in publications.

  5. What is the shipping cost for "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LRRC4C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LRRC4C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LRRC4C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LRRC4C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LRRC4C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LRRC4C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)
Your Rating
We found other products you might like!