Search Antibody, Protein, and ELISA Kit Solutions

LRRC4C Antibody - N-terminal region : FITC (ARP49593_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49593_P050 Unconjugated

ARP49593_P050-HRP Conjugated

ARP49593_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Leucine rich repeat containing 4C
NCBI Gene Id:
Protein Name:
Leucine-rich repeat-containing protein 4C
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KIAA1580, NGL-1, NGL1
Replacement Item:
This antibody may replace item sc-51377 from Santa Cruz Biotechnology.
Description of Target:
NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRRC4C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRRC4C.
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-LRRC4C (ARP49593_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LRRC4C (ARP49593_P050-FITC) antibody is Catalog # AAP49593 (Previous Catalog # AAPP29442)
Printable datasheet for anti-LRRC4C (ARP49593_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Lin,J.C., (2003) Nat. Neurosci. 6 (12), 1270-1276

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...