Search Antibody, Protein, and ELISA Kit Solutions

LRRC4C Antibody - N-terminal region (ARP49593_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49593_P050-FITC Conjugated

ARP49593_P050-HRP Conjugated

ARP49593_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Leucine rich repeat containing 4C
NCBI Gene Id:
Protein Name:
Leucine-rich repeat-containing protein 4C
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KIAA1580, NGL-1, NGL1
Replacement Item:
This antibody may replace item sc-51377 from Santa Cruz Biotechnology.
Description of Target:
NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRRC4C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRRC4C.
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-LRRC4C (ARP49593_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LRRC4C (ARP49593_P050) antibody is Catalog # AAP49593 (Previous Catalog # AAPP29442)
Printable datasheet for anti-LRRC4C (ARP49593_P050) antibody
Target Reference:
Lin,J.C., (2003) Nat. Neurosci. 6 (12), 1270-1276

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...