LRRC15 Antibody - N-terminal region (ARP50292_P050)

Catalog No: ARP50292_P050

Host: Rabbit
Target Name: LRRC15
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/mlLRRC15 is supported by BioGPS gene expression data to be expressed in 721_B

WB Suggested Anti-LRRC15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate

Host: Rabbit
Target Name: LRRC15
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 2ug/ml

Host: Rabbit
Target: LRRC15
Positive control (+): Human Lung (LU)
Negative control (-): Human Fetal Heart (HE)
Antibody concentration: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC15
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LRRC15 (ARP50292_P050) antibody is Catalog # AAP50292 (Previous Catalog # AAPY03370)
• Sample Type Confirmation:

  LRRC15 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Muzny,D.M., (2006) Nature 440 (7088), 1194-1198

Target Info

• Gene Symbol: LRRC15
• Gene Full Name: Leucine rich repeat containing 15
• Alias Symbols: LIB
• NCBI Gene Id: 131578
• Protein Name: Leucine-rich repeat-containing protein 15
• Description of Target: LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.
• Uniprot ID: Q8TF66
• Protein Accession #: NP_570843
• Nucleotide Accession #: NM_130830
• Protein Size (# AA): 581
• Molecular Weight: 64kDa
• Protein Interactions: TARDBP; KHDRBS2; USP15;