Search Antibody, Protein, and ELISA Kit Solutions

LRPPRC Antibody - N-terminal region (ARP41093_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41093_P050-FITC Conjugated

ARP41093_P050-HRP Conjugated

ARP41093_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
LRPPRC
Official Gene Full Name:
leucine rich pentatricopeptide repeat containing
NCBI Gene Id:
10128
Protein Name:
leucine-rich PPR motif-containing protein, mitochondrial
Swissprot Id:
P42704
Protein Accession #:
NP_573566
Alias Symbols:
LSFC, GP130, LRP130, CLONE-23970
Description of Target:
This gene encodes a leucine-rich protein that has multiple pentatricopeptide repeats (PPR). The precise role of this protein is unknown but studies suggest it may play a role in cytoskeletal organization, vesicular transport, or in transcriptional regulation of both nuclear and mitochondrial genes. The protein localizes primarily to mitochondria and is predicted to have an N-terminal mitochondrial targeting sequence. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome.
Protein Size (# AA):
1394
Molecular Weight:
153kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRPPRC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRPPRC.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPPRC
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-LRPPRC (ARP41093_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SPRTN; CEP76; HAUS2; CEP250; SART3; AURKB; TP53; AURKA; SUMO2; SUMO3; CDKN1A; IVNS1ABP; STAU1; UBC; MDM2; LGR4; ASB5; RNF2; EZH2; BMI1; PARK2; FBXO6; ADRB2; METTL22; vpu; ITGA4; FN1; C1QBP; VCAM1; PEX14; SMURF1; ILF3; CPS1; MRPS35; SEC23A; GRK5; UBD; CDK2
Blocking Peptide:
For anti-LRPPRC (ARP41093_P050) antibody is Catalog # AAP41093
Datasheets/Manuals:
Printable datasheet for anti-LRPPRC (ARP41093_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...