Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41093_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41093_P050-FITC Conjugated

ARP41093_P050-HRP Conjugated

ARP41093_P050-Biotin Conjugated

LRPPRC Antibody - N-terminal region (ARP41093_P050)

Catalog#: ARP41093_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPPRC
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-LRPPRC (ARP41093_P050)
Peptide Sequence Synthetic peptide located within the following region: NEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LRPPRC (ARP41093_P050) antibody is Catalog # AAP41093
Datasheets/Manuals Printable datasheet for anti-LRPPRC (ARP41093_P050) antibody
Target Reference N/A
Gene Symbol LRPPRC
Official Gene Full Name leucine rich pentatricopeptide repeat containing
Alias Symbols LSFC, GP130, LRP130, CLONE-23970
NCBI Gene Id 10128
Protein Name leucine-rich PPR motif-containing protein, mitochondrial
Description of Target This gene encodes a leucine-rich protein that has multiple pentatricopeptide repeats (PPR). The precise role of this protein is unknown but studies suggest it may play a role in cytoskeletal organization, vesicular transport, or in transcriptional regulation of both nuclear and mitochondrial genes. The protein localizes primarily to mitochondria and is predicted to have an N-terminal mitochondrial targeting sequence. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome.
Swissprot Id P42704
Protein Accession # NP_573566
Protein Size (# AA) 1394
Molecular Weight 153kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LRPPRC.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LRPPRC.
Protein Interactions SPRTN; CEP76; HAUS2; CEP250; SART3; AURKB; TP53; AURKA; SUMO2; SUMO3; CDKN1A; IVNS1ABP; STAU1; UBC; MDM2; LGR4; ASB5; RNF2; EZH2; BMI1; PARK2; FBXO6; ADRB2; METTL22; vpu; ITGA4; FN1; C1QBP; VCAM1; PEX14; SMURF1; ILF3; CPS1; MRPS35; SEC23A; GRK5; UBD; CDK2
  1. What is the species homology for "LRPPRC Antibody - N-terminal region (ARP41093_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "LRPPRC Antibody - N-terminal region (ARP41093_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LRPPRC Antibody - N-terminal region (ARP41093_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LRPPRC Antibody - N-terminal region (ARP41093_P050)"?

    This target may also be called "LSFC, GP130, LRP130, CLONE-23970" in publications.

  5. What is the shipping cost for "LRPPRC Antibody - N-terminal region (ARP41093_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LRPPRC Antibody - N-terminal region (ARP41093_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LRPPRC Antibody - N-terminal region (ARP41093_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "153kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LRPPRC Antibody - N-terminal region (ARP41093_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LRPPRC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LRPPRC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LRPPRC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LRPPRC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LRPPRC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LRPPRC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LRPPRC Antibody - N-terminal region (ARP41093_P050)
Your Rating