Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP58562_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58562_P050-FITC Conjugated

ARP58562_P050-HRP Conjugated

ARP58562_P050-Biotin Conjugated

LRP1 Antibody - middle region (ARP58562_P050)

Catalog#: ARP58562_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-16166 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LRP1
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LRP1 (ARP58562_P050) antibody is Catalog # AAP58562 (Previous Catalog # AAPP35508)
Datasheets/Manuals Printable datasheet for anti-LRP1 (ARP58562_P050) antibody
Publications

Behl, M., Zhang, Y., Monnot, A. D., Jiang, W. & Zheng, W. Increased beta-amyloid levels in the choroid plexus following lead exposure and the involvement of low-density lipoprotein receptor protein-1. Toxicol. Appl. Pharmacol. 240, 245-54 (2009). IHC, WB, Human 19501112

Gu, H. et al. Lead exposure increases levels of b-amyloid in the brain and CSF and inhibits LRP1 expression in APP transgenic mice. Neurosci. Lett. 490, 16-20 (2011). IHC, WB, Human 21167913

Hentschke, M. R. et al. Is the atherosclerotic phenotype of preeclamptic placentas due to altered lipoprotein concentrations and placental lipoprotein receptors? Role of a small-for-gestational-age phenotype. J. Lipid Res. 54, 2658-64 (2013). IHC, WB, Human 23898049

Gene Symbol LRP1
Official Gene Full Name Low density lipoprotein receptor-related protein 1
Alias Symbols APR, LRP, A2MR, CD91, APOER, TGFBR5, IGFBP3R
NCBI Gene Id 4035
Protein Name Prolow-density lipoprotein receptor-related protein 1
Description of Target Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
Swissprot Id Q07954
Protein Accession # AAH21204
Nucleotide Accession # NM_002332
Protein Size (# AA) 439
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LRP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LRP1.
Protein Interactions UBC; COPS5; APP; RANBP9; SKIL; CHFR; CUBN; FBXO6; ANKS1B; RIC8B; PID1; CC2D1A; MAPRE1; HNRNPDL; MAPK8IP1; SNRNP70; APOE; CACNA1A; USP3; CAV1; MMP14; SHC1; MMP13; SERPINA1; F9; F8; LPL; HSP90B1; SRC; PDGFB; THBS1; SCN3A; PLAUR; PLAT; SERPINE1; MDK; LIPC; L
  1. What is the species homology for "LRP1 Antibody - middle region (ARP58562_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "LRP1 Antibody - middle region (ARP58562_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LRP1 Antibody - middle region (ARP58562_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LRP1 Antibody - middle region (ARP58562_P050)"?

    This target may also be called "APR, LRP, A2MR, CD91, APOER, TGFBR5, IGFBP3R" in publications.

  5. What is the shipping cost for "LRP1 Antibody - middle region (ARP58562_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LRP1 Antibody - middle region (ARP58562_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LRP1 Antibody - middle region (ARP58562_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LRP1 Antibody - middle region (ARP58562_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LRP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LRP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LRP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LRP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LRP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LRP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LRP1 Antibody - middle region (ARP58562_P050)
Your Rating
We found other products you might like!