Search Antibody, Protein, and ELISA Kit Solutions

LRP1 Antibody - middle region (ARP58562_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58562_P050-FITC Conjugated

ARP58562_P050-HRP Conjugated

ARP58562_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Low density lipoprotein receptor-related protein 1
NCBI Gene Id:
Protein Name:
Prolow-density lipoprotein receptor-related protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-16166 from Santa Cruz Biotechnology.
Description of Target:
Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRP1.
The immunogen is a synthetic peptide directed towards the middle region of human LRP1
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LRP1 (ARP58562_P050) antibody is Catalog # AAP58562 (Previous Catalog # AAPP35508)
Printable datasheet for anti-LRP1 (ARP58562_P050) antibody

Behl, M., Zhang, Y., Monnot, A. D., Jiang, W. & Zheng, W. Increased beta-amyloid levels in the choroid plexus following lead exposure and the involvement of low-density lipoprotein receptor protein-1. Toxicol. Appl. Pharmacol. 240, 245-54 (2009). IHC, WB, Human 19501112

Gu, H. et al. Lead exposure increases levels of b-amyloid in the brain and CSF and inhibits LRP1 expression in APP transgenic mice. Neurosci. Lett. 490, 16-20 (2011). IHC, WB, Human 21167913

Hentschke, M. R. et al. Is the atherosclerotic phenotype of preeclamptic placentas due to altered lipoprotein concentrations and placental lipoprotein receptors? Role of a small-for-gestational-age phenotype. J. Lipid Res. 54, 2658-64 (2013). IHC, WB, Human 23898049

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...