Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP58562_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58562_P050-FITC Conjugated

ARP58562_P050-HRP Conjugated

ARP58562_P050-Biotin Conjugated

LRP1 Antibody - middle region (ARP58562_P050)

Catalog#: ARP58562_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-16166 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LRP1
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LRP1 (ARP58562_P050) antibody is Catalog # AAP58562 (Previous Catalog # AAPP35508)
Datasheets/Manuals Printable datasheet for anti-LRP1 (ARP58562_P050) antibody
Publications

Behl, M., Zhang, Y., Monnot, A. D., Jiang, W. & Zheng, W. Increased beta-amyloid levels in the choroid plexus following lead exposure and the involvement of low-density lipoprotein receptor protein-1. Toxicol. Appl. Pharmacol. 240, 245-54 (2009). IHC, WB, Human 19501112

Gu, H. et al. Lead exposure increases levels of b-amyloid in the brain and CSF and inhibits LRP1 expression in APP transgenic mice. Neurosci. Lett. 490, 16-20 (2011). IHC, WB, Human 21167913

Hentschke, M. R. et al. Is the atherosclerotic phenotype of preeclamptic placentas due to altered lipoprotein concentrations and placental lipoprotein receptors? Role of a small-for-gestational-age phenotype. J. Lipid Res. 54, 2658-64 (2013). IHC, WB, Human 23898049

Gene Symbol LRP1
Official Gene Full Name Low density lipoprotein receptor-related protein 1
Alias Symbols APR, LRP, A2MR, CD91, APOER, TGFBR5, IGFBP3R
NCBI Gene Id 4035
Protein Name Prolow-density lipoprotein receptor-related protein 1
Description of Target Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
Swissprot Id Q07954
Protein Accession # AAH21204
Nucleotide Accession # NM_002332
Protein Size (# AA) 439
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LRP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LRP1.
Protein Interactions UBC; COPS5; APP; RANBP9; SKIL; CHFR; CUBN; FBXO6; ANKS1B; RIC8B; PID1; CC2D1A; MAPRE1; HNRNPDL; MAPK8IP1; SNRNP70; APOE; CACNA1A; USP3; CAV1; MMP14; SHC1; MMP13; SERPINA1; F9; F8; LPL; HSP90B1; SRC; PDGFB; THBS1; SCN3A; PLAUR; PLAT; SERPINE1; MDK; LIPC; L
Write Your Own Review
You're reviewing:LRP1 Antibody - middle region (ARP58562_P050)
Your Rating