LRMP Antibody - C-terminal region (ARP62087_P050)

Catalog No: ARP62087_P050

WB Suggested Anti-LRMP Antibody
Titration: 1.0 ug/ml
Positive Control: A549 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 83%; Horse: 86%; Human: 100%; Rabbit: 85%
• Peptide Sequence: Synthetic peptide located within the following region: SKQSEHRPSLPRFISTYSWADAEEEKCELKTKDDSEPSGEETVERTRKPS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LRMP (ARP62087_P050) antibody is Catalog # AAP62087

Target Info

• Gene Symbol: LRMP
• Gene Full Name: Lymphoid-restricted membrane protein
• Alias Symbols: JAW1, LRMP
• NCBI Gene Id: 4033
• Protein Name: Lymphoid-restricted membrane protein
• Description of Target: The protein encode dby this gene is expressed in a developmentally regulated manner in lymphoid cell lines and tissues. The protein is localized to the cytoplasmic face of the endoplasmic reticulum.
• Uniprot ID: Q12912-2
• Protein Accession #: NP_006143
• Nucleotide Accession #: NM_006152
• Protein Size (# AA): 499
• Molecular Weight: 55kDa
• Protein Interactions: YWHAZ; YWHAE;