Search Antibody, Protein, and ELISA Kit Solutions

LRG1 Antibody - N-terminal region (ARP52475_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP52475_P050-FITC Conjugated

ARP52475_P050-HRP Conjugated

ARP52475_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Human, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-121396 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LRG1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Human: 100%; Pig: 79%
Complete computational species homology data:
Anti-LRG1 (ARP52475_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-LRG1 (ARP52475_P050) antibody is Catalog # AAP52475 (Previous Catalog # AAPP42935)
Datasheets/Manuals:
Printable datasheet for anti-LRG1 (ARP52475_P050) antibody
Publications:

O’Hanlon, T. P. et al. Plasma proteomic profiles from disease-discordant monozygotic twins suggest that molecular pathways are shared in multiple systemic autoimmune diseases. Arthritis Res. Ther. 13, R181 (2011). WB, Cow, Human, Pig 22044644

Gene Symbol:
LRG1
Official Gene Full Name:
Leucine-rich alpha-2-glycoprotein 1
Alias Symbols:
HMFT1766, LRG
NCBI Gene Id:
116844
Protein Name:
Leucine-rich alpha-2-glycoprotein
Description of Target:
The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).
Swissprot Id:
P02750
Protein Accession #:
NP_443204
Nucleotide Accession #:
NM_052972
Protein Size (# AA):
347
Molecular Weight:
38kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRG1.
Protein Interactions:
FN1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...