Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52475_P050-FITC Conjugated

ARP52475_P050-HRP Conjugated

ARP52475_P050-Biotin Conjugated

LRG1 Antibody - N-terminal region (ARP52475_P050)

Catalog#: ARP52475_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Human, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-121396 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRG1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Human: 100%; Pig: 79%
Complete computational species homology data Anti-LRG1 (ARP52475_P050)
Peptide Sequence Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LRG1 (ARP52475_P050) antibody is Catalog # AAP52475 (Previous Catalog # AAPP42935)
Datasheets/Manuals Printable datasheet for anti-LRG1 (ARP52475_P050) antibody

O’Hanlon, T. P. et al. Plasma proteomic profiles from disease-discordant monozygotic twins suggest that molecular pathways are shared in multiple systemic autoimmune diseases. Arthritis Res. Ther. 13, R181 (2011). WB, Cow, Human, Pig 22044644

Gene Symbol LRG1
Official Gene Full Name Leucine-rich alpha-2-glycoprotein 1
Alias Symbols HMFT1766, LRG
NCBI Gene Id 116844
Protein Name Leucine-rich alpha-2-glycoprotein
Description of Target The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).
Swissprot Id P02750
Protein Accession # NP_443204
Nucleotide Accession # NM_052972
Protein Size (# AA) 347
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LRG1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LRG1.
Protein Interactions FN1;
  1. What is the species homology for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Human, Pig".

  2. How long will it take to receive "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LRG1 Antibody - N-terminal region (ARP52475_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    This target may also be called "HMFT1766, LRG" in publications.

  5. What is the shipping cost for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LRG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LRG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LRG1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LRG1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LRG1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LRG1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LRG1 Antibody - N-terminal region (ARP52475_P050)
Your Rating
We found other products you might like!