Search Antibody, Protein, and ELISA Kit Solutions

LRG1 antibody - N-terminal region (ARP52475_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52475_P050-FITC Conjugated

ARP52475_P050-HRP Conjugated

ARP52475_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Leucine-rich alpha-2-glycoprotein 1
Protein Name:
Leucine-rich alpha-2-glycoprotein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-121396 from Santa Cruz Biotechnology.
Description of Target:
The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LRG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LRG1.
The immunogen is a synthetic peptide directed towards the N terminal region of human LRG1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Human: 100%; Pig: 79%
Complete computational species homology data:
Anti-LRG1 (ARP52475_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LRG1 (ARP52475_P050) antibody is Catalog # AAP52475 (Previous Catalog # AAPP42935)
Printable datasheet for anti-LRG1 (ARP52475_P050) antibody

O’Hanlon, T. P. et al. Plasma proteomic profiles from disease-discordant monozygotic twins suggest that molecular pathways are shared in multiple systemic autoimmune diseases. Arthritis Res. Ther. 13, R181 (2011). WB, Cow, Human, Pig 22044644

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...