LRCH4 Antibody - middle region (ARP45269_P050)

Catalog No: ARP45269_P050

WB Suggested Anti-LRCH4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRCH4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: DLMTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LRCH4 (ARP45269_P050) antibody is Catalog # AAP45269 (Previous Catalog # AAPY01226)
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: LRCH4
• Gene Full Name: Leucine-rich repeats and calponin homology (CH) domain containing 4
• Alias Symbols: LRN, LRRN1, LRRN4, PP14183
• NCBI Gene Id: 4034
• Protein Name: Leucine-rich repeat and calponin homology domain-containing protein 4
• Description of Target: The specific function of LRCH4 is not yet known.This gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded protein resembles a receptor.
• Uniprot ID: O75427
• Protein Accession #: NP_002310
• Nucleotide Accession #: NM_002319
• Protein Size (# AA): 683
• Molecular Weight: 73kDa
• Protein Interactions: NOTCH2NL; KRTAP10-8; KRTAP10-7; KRT40; FBXW11; DOCK7; SUGT1; MDFI; TADA2A; SIN3A; RTN4; CA8; RBBP6;