LPL Antibody - middle region (ARP97751_P050)

Catalog No: ARP97751_P050

Host: Rabbit
Target Name: LPL
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LPL
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: YESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVAR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LPL (ARP97751_P050) antibody is Catalog # AAP97751

Target Info

• Gene Symbol: LPL
• Gene Full Name: lipoprotein lipase
• Alias Symbols: LIPD, HDLCQ11
• NCBI Gene Id: 4023
• Protein Name: LIPD, HDLCQ11
• Description of Target: LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.
• Uniprot ID: P06858
• Protein Accession #: NP_000228.1
• Nucleotide Accession #: NM_000237.2
• Protein Size (# AA): 475
• Molecular Weight: 52 kDa