Size:100 ul
$289.00
In Stock
SKU
ARP53826_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53826_P050 Unconjugated

ARP53826_P050-HRP Conjugated

ARP53826_P050-Biotin Conjugated

LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)

Catalog#: ARP53826_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-376874 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91%
Complete computational species homology data Anti-LPIN1 (ARP53826_P050)
Peptide Sequence Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
Concentration 0.5 mg/ml
Blocking Peptide For anti-LPIN1 (ARP53826_P050-FITC) antibody is Catalog # AAP53826 (Previous Catalog # AAPP30863)
Datasheets/Manuals Printable datasheet for anti-LPIN1 (ARP53826_P050-FITC) antibody
Sample Type Confirmation

LPIN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference Ong,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545
Gene Symbol LPIN1
Official Gene Full Name Lipin 1
Alias Symbols DKFZp781P1796, KIAA0188, PAP1
NCBI Gene Id 23175
Protein Name Phosphatidate phosphatase LPIN1
Description of Target This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q14693
Protein Accession # NP_663731
Nucleotide Accession # NM_145693
Protein Size (# AA) 890
Molecular Weight 98kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LPIN1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LPIN1.
Protein Interactions FBXW11; PAH1; CDK6; UBC; PPARA; NFATC4;
  1. What is the species homology for "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish".

  2. How long will it take to receive "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)"?

    This target may also be called "DKFZp781P1796, KIAA0188, PAP1" in publications.

  5. What is the shipping cost for "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "98kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LPIN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LPIN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LPIN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LPIN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LPIN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LPIN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)
Your Rating
We found other products you might like!