Search Antibody, Protein, and ELISA Kit Solutions

LPIN1 antibody - N-terminal region (ARP53826_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53826_P050-FITC Conjugated

ARP53826_P050-HRP Conjugated

ARP53826_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Lipin 1
Protein Name:
Phosphatidate phosphatase LPIN1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp781P1796, KIAA0188, PAP1
Replacement Item:
This antibody may replace item sc-376874 from Santa Cruz Biotechnology.
Description of Target:
This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LPIN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LPIN1.
The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91%
Complete computational species homology data:
Anti-LPIN1 (ARP53826_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LPIN1 (ARP53826_P050) antibody is Catalog # AAP53826 (Previous Catalog # AAPP30863)
Printable datasheet for anti-LPIN1 (ARP53826_P050) antibody
Sample Type Confirmation:

LPIN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Ong,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...