Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP53826_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53826_P050-FITC Conjugated

ARP53826_P050-HRP Conjugated

ARP53826_P050-Biotin Conjugated

LPIN1 Antibody - N-terminal region (ARP53826_P050)

Catalog#: ARP53826_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-376874 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91%
Complete computational species homology dataAnti-LPIN1 (ARP53826_P050)
Peptide SequenceSynthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-LPIN1 (ARP53826_P050) antibody is Catalog # AAP53826 (Previous Catalog # AAPP30863)
Datasheets/ManualsPrintable datasheet for anti-LPIN1 (ARP53826_P050) antibody
Sample Type Confirmation

LPIN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target ReferenceOng,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545
Gene SymbolLPIN1
Official Gene Full NameLipin 1
Alias SymbolsDKFZp781P1796, KIAA0188, PAP1
NCBI Gene Id23175
Protein NamePhosphatidate phosphatase LPIN1
Description of TargetThis gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdQ14693
Protein Accession #NP_663731
Nucleotide Accession #NM_145693
Protein Size (# AA)890
Molecular Weight98kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express LPIN1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express LPIN1.
Protein InteractionsFBXW11; PAH1; CDK6; UBC; PPARA; NFATC4;
Write Your Own Review
You're reviewing:LPIN1 Antibody - N-terminal region (ARP53826_P050)
Your Rating
Assay Development
Aviva Blast Tool
Aviva Validation Data
Aviva HIS tag Deal