Search Antibody, Protein, and ELISA Kit Solutions

LOXL2 Antibody - C-terminal region (ARP74037_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74037_P050-FITC Conjugated

ARP74037_P050-HRP Conjugated

ARP74037_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
LOXL2
NCBI Gene Id:
4017
Swissprot Id:
Q9Y4K0
Protein Accession #:
NP_002309
Alias Symbols:
LOXL2,
Replacement Item:
This antibody may replace item sc-293427 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
Protein Size (# AA):
774
Molecular Weight:
85kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LOXL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LOXL2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LOXL2
Peptide Sequence:
Synthetic peptide located within the following region: MEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO1; PDIA3;
Blocking Peptide:
For anti-LOXL2 (ARP74037_P050) antibody is Catalog # AAP74037
Datasheets/Manuals:
Printable datasheet for anti-LOXL2 (ARP74037_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...