SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54780_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP54780_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-LOXL1 (ARP54780_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LOXL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 83%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR
Concentration0.5 mg/ml
Blocking PeptideFor anti-LOXL1 (ARP54780_P050-Biotin) antibody is Catalog # AAP54780 (Previous Catalog # AAPP31575)
ReferenceOzaki,M., (er) Invest. Ophthalmol. Vis. Sci. (2008) In press
Publications

Ohmura, H. et al. Cardiomyocyte-specific transgenic expression of lysyl oxidase-like protein-1 induces cardiac hypertrophy in mice. Hypertens. Res. 35, 1063-8 (2012). WB, Pig, Rat, Guinea pig, Human, Mouse, Horse, Rabbit, Bovine 22763477

Gene SymbolLOXL1
Gene Full NameLysyl oxidase-like 1
Alias SymbolsLOL, LOXL
NCBI Gene Id4016
Protein NameLysyl oxidase homolog 1
Description of TargetLOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ08397
Protein Accession #NP_005567
Nucleotide Accession #NM_005576
Protein Size (# AA)574
Molecular Weight53kDa
Protein InteractionsATXN1; CUL2; FBLN5; ELN;
  1. What is the species homology for "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)"?

    This target may also be called "LOL, LOXL" in publications.

  5. What is the shipping cost for "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LOXL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LOXL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LOXL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LOXL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LOXL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LOXL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LOXL1 Antibody - N-terminal region : Biotin (ARP54780_P050-Biotin)
Your Rating
We found other products you might like!