Search Antibody, Protein, and ELISA Kit Solutions

LOXL1 Antibody - N-terminal region (ARP54780_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54780_P050-FITC Conjugated

ARP54780_P050-HRP Conjugated

ARP54780_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Lysyl oxidase-like 1
NCBI Gene Id:
Protein Name:
Lysyl oxidase homolog 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-166632 from Santa Cruz Biotechnology.
Description of Target:
LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
63 kDa
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LOXL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LOXL1.
The immunogen is a synthetic peptide directed towards the N terminal region of human LOXL1
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 83%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-LOXL1 (ARP54780_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LOXL1 (ARP54780_P050) antibody is Catalog # AAP54780 (Previous Catalog # AAPP31575)
Printable datasheet for anti-LOXL1 (ARP54780_P050) antibody
Target Reference:
Ozaki,M., (er) Invest. Ophthalmol. Vis. Sci. (2008) In press

Ohmura, H. et al. Cardiomyocyte-specific transgenic expression of lysyl oxidase-like protein-1 induces cardiac hypertrophy in mice. Hypertens. Res. 35, 1063-8 (2012). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22763477

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...