Size:100 ul
$319.00
In Stock
SKU
ARP54780_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54780_P050-FITC Conjugated

ARP54780_P050-HRP Conjugated

ARP54780_P050-Biotin Conjugated

LOXL1 Antibody - N-terminal region (ARP54780_P050)

Catalog#: ARP54780_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-166632 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LOXL1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 83%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data Anti-LOXL1 (ARP54780_P050)
Peptide Sequence Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LOXL1 (ARP54780_P050) antibody is Catalog # AAP54780 (Previous Catalog # AAPP31575)
Datasheets/Manuals Printable datasheet for anti-LOXL1 (ARP54780_P050) antibody
Target Reference Ozaki,M., (er) Invest. Ophthalmol. Vis. Sci. (2008) In press
Publications

Ohmura, H. et al. Cardiomyocyte-specific transgenic expression of lysyl oxidase-like protein-1 induces cardiac hypertrophy in mice. Hypertens. Res. 35, 1063-8 (2012). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22763477

Gene Symbol LOXL1
Official Gene Full Name Lysyl oxidase-like 1
Alias Symbols LOL, LOXL
NCBI Gene Id 4016
Protein Name Lysyl oxidase homolog 1
Description of Target LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q08397
Protein Accession # NP_005567
Nucleotide Accession # NM_005576
Protein Size (# AA) 574
Molecular Weight 63 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LOXL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LOXL1.
Protein Interactions ATXN1; CUL2; FBLN5; ELN;
  1. What is the species homology for "LOXL1 Antibody - N-terminal region (ARP54780_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "LOXL1 Antibody - N-terminal region (ARP54780_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LOXL1 Antibody - N-terminal region (ARP54780_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LOXL1 Antibody - N-terminal region (ARP54780_P050)"?

    This target may also be called "LOL, LOXL" in publications.

  5. What is the shipping cost for "LOXL1 Antibody - N-terminal region (ARP54780_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LOXL1 Antibody - N-terminal region (ARP54780_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LOXL1 Antibody - N-terminal region (ARP54780_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LOXL1 Antibody - N-terminal region (ARP54780_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LOXL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LOXL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LOXL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LOXL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LOXL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LOXL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LOXL1 Antibody - N-terminal region (ARP54780_P050)
Your Rating
We found other products you might like!