Long R3 IGF1 Protein (OOPA00037)

Catalog No: OOPA00037 (Formerly GWB-BSP044)

Size:100ug

Product Info

• Product Format: Sterile Filtered White lyophilized (freeze-dried) powder.
• Host: Escherichia Coli.
• Additional Information: Solubility: It is recommended to Reconstitution: Reconstitute the lyophilized Long R3 IGF1 in sterile 18M?-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
  Product Introduction: IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.
  Product Description: The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human Long R3 Insulin Like Growth Factor-1 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa.
• Reconstitution and Storage: Lyophilized Long R3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution the Long R3 IGF1 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
• Formulation: Lyophilized from a 0.2um filtered concentrated solution in 1xPBS.
• Purification: Greater than 95.0% as determined by SDS-PAGE.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Biological Activity: The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less then 1ng/ml, corresponding to a specific activity of 1,000,000 units/mg.
• Peptide Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.

Target Info

• Gene Symbol: Long R3 IGF1
• Alias Symbols: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.