Catalog No: ARP54457_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LOC284009 Antibody - N-terminal region (ARP54457_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-LOC284009 (ARP54457_P050) antibody
Product Info
ReferenceOta,T., (2004) Nat. Genet. 36 (1), 40-45
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LOC284009
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDI
Concentration0.5 mg/ml
Blocking PeptideFor anti-LOC284009 (ARP54457_P050) antibody is Catalog # AAP54457 (Previous Catalog # AAPP31237)
Gene SymbolLOC284009
Gene Full NameUncharacterized LOC284009
Alias SymbolsMGC138239
NCBI Gene Id284009
Protein NamePutative uncharacterized protein LOC284009 EMBL AAH93711.1
Description of TargetThe exact function of LOC284009 remains unknown.
Uniprot IDQ4G0H6
Protein Accession #NP_001020630
Nucleotide Accession #NM_001025459
Protein Size (# AA)157
Molecular Weight17kDa
  1. What is the species homology for "LOC284009 Antibody - N-terminal region (ARP54457_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "LOC284009 Antibody - N-terminal region (ARP54457_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LOC284009 Antibody - N-terminal region (ARP54457_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "LOC284009 Antibody - N-terminal region (ARP54457_P050)"?

    This target may also be called "MGC138239" in publications.

  5. What is the shipping cost for "LOC284009 Antibody - N-terminal region (ARP54457_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LOC284009 Antibody - N-terminal region (ARP54457_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LOC284009 Antibody - N-terminal region (ARP54457_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LOC284009 Antibody - N-terminal region (ARP54457_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LOC284009"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LOC284009"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LOC284009"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LOC284009"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LOC284009"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LOC284009"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LOC284009 Antibody - N-terminal region (ARP54457_P050)
Your Rating