$0.00
In Stock
SKU
OPCA20587
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

LOC105023357 Recombinant Protein (Northern pike) (OPCA20587)

Catalog#: OPCA20587
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Northern pike
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence MENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKHETQKSSVLKLLHISFRLIESWEYPSQTLTHTMSNNLNQNQMSEKLSNLKVGINLLIKGNQEDVPSLDDNDSQQLLPYGNYYQNLGDNDNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA20587
Gene Symbol LOC105023357
Alias Symbols GH, pre-GH
NCBI Gene Id 105023357
Protein Name somatotropin
Swissprot Id P34744
Protein Size (# AA) 187
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LOC105023357.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LOC105023357.
Write Your Own Review
You're reviewing:LOC105023357 Recombinant Protein (Northern pike) (OPCA20587)
Your Rating