Catalog No: OPCA20620
Price: $0.00
SKU
OPCA20620
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ LOC101039453 Recombinant Protein (Bolivian squirrel monkey) (OPCA20620)
| Datasheets/Manuals | Printable datasheet for OPCA20620 |
|---|
| Predicted Species Reactivity | Bolivian squirrel monkey |
|---|---|
| Product Format | Liquid |
| Application | WB, ELISA |
| Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | FPTIPLSRLLDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPASKKETQQKSNLELLRISLILIQSWFEPVQLLRSVFANSLLYGVSDSDVYEYLKDLEEGIQTLMERLEDGSPRTGAIFRQTYSKFDINSQNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Protein Range | 27-217 |
| Alias Symbols | GH1 |
|---|---|
| NCBI Gene Id | 101039453 |
| Protein Name | somatotropin-like |
| Uniprot ID | P58343 |
| Protein Accession # | NP_001266907.1 |
| Nucleotide Accession # | NM_001279978.1 |
| Protein Size (# AA) | 191 |
Write Your Own Review