Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LMO2 Antibody : Biotin (ARP31307_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock

Conjugation Options

ARP31307_P050 Unconjugated

ARP31307_P050-FITC Conjugated

ARP31307_P050-HRP Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
LMO2
NCBI Gene Id:
4005
Official Gene Full Name:
LIM domain only 2 (rhombotin-like 1)
Protein Name:
Rhombotin-2
Swissprot Id:
P25791
Protein Accession #:
NP_005565
Nucleotide Accession #:
NM_001142315
Alias Symbols:
TTG2, RBTN2, RHOM2, RBTNL1,
Description of Target:
LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
158
Molecular Weight:
18 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LMO2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LMO2.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence RATKGAPPPPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGC
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-LMO2 (ARP31307_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RATKGAPPPPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
ADAMTSL4; MBIP; HOOK1; TFPT; NOTCH2NL; KRTAP10-7; CCDC36; NUTM1; SPERT; FAM154A; CLHC1; KRT40; SSX2IP; CMTM5; MRFAP1L1; IFT43; C1orf94; LZTS2; TSC22D4; DBF4B; CCDC33; RINT1; NIF3L1; TRIM54; AGTRAP; ZFP64; BANP; STAT3; STAT1; SOX5; SKP1; ROCK1; REL; PRKG1;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-LMO2 (ARP31307_P050-Biotin) antibody
Conjugation:
Biotin

Tell us what you think about this item!

Write A Review
    Please, wait...