LMNB2 Antibody - N-terminal region (ARP46356_P050)

Size:100 ul

Human Jurkat

Mouse C2C12 cells

Basic Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-121281 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LMNB2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 92%
• Complete computational species homology data: Anti-LMNB2 (ARP46356_P050)
• Peptide Sequence: Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-LMNB2 (ARP46356_P050) antibody is Catalog # AAP46356 (Previous Catalog # AAPP27142)
• Datasheets/Manuals: Printable datasheet for anti-LMNB2 (ARP46356_P050) antibody
• Sample Type Confirmation:

  LMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat

• Target Reference: Tsai,M.Y., (2006) Science 311 (5769), 1887-1893
• Publications:

  Jacinto, FV; Benner, C; Hetzer, MW; The nucleoporin Nup153 regulates embryonic stem cell pluripotency through gene silencing. 29, 1224-38 (2015). WB, IHC, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26080816

Target Info

• Gene Symbol: LMNB2
• Official Gene Full Name: Lamin B2
• Alias Symbols: LAMB2, LMN2, MGC2721
• NCBI Gene Id: 84823
• Protein Name: Lamin-B2
• Description of Target: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B2. This gene is in a head-to-tail orientation with the gene for the translocase of inner mitochondrial membrane 13 homolog gene.
• Swissprot Id: Q03252
• Protein Accession #: NP_116126
• Nucleotide Accession #: NM_032737
• Protein Size (# AA): 600
• Molecular Weight: 68kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express LMNB2.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express LMNB2.
• Protein Interactions: UBC; GPRASP2; SUZ12; EED; RNF2; LMNA; PAN2; VCP; UBD; SIRT7; ELAVL1; SVIL; BANF1; PRKCD; LMNB2; TMPO; XRCC5; ORC2;