Search Antibody, Protein, and ELISA Kit Solutions

LMNB2 Antibody - N-terminal region (ARP46356_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46356_P050-FITC Conjugated

ARP46356_P050-HRP Conjugated

ARP46356_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Lamin B2
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
LAMB2, LMN2, MGC2721
Replacement Item:
This antibody may replace item sc-121281 from Santa Cruz Biotechnology.
Description of Target:
The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B2. This gene is in a head-to-tail orientation with the gene for the translocase of inner mitochondrial membrane 13 homolog gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LMNB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LMNB2.
The immunogen is a synthetic peptide directed towards the N terminal region of human LMNB2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 92%
Complete computational species homology data:
Anti-LMNB2 (ARP46356_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LMNB2 (ARP46356_P050) antibody is Catalog # AAP46356 (Previous Catalog # AAPP27142)
Printable datasheet for anti-LMNB2 (ARP46356_P050) antibody
Sample Type Confirmation:

LMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Tsai,M.Y., (2006) Science 311 (5769), 1887-1893

Jacinto, FV; Benner, C; Hetzer, MW; The nucleoporin Nup153 regulates embryonic stem cell pluripotency through gene silencing. 29, 1224-38 (2015). WB, IHC, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26080816

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: LMNB2 antibody - N-terminal region (ARP46356_P050) in Mouse C2C12 cells using IHC
Product page for LMNB2 antibody - N-terminal region (ARP46356_P050)

Researcher: Dr. David Razafsky, Washington University in Saint Louis
Application: IHC
Species + Tissue/Cell type: Mouse C2C12 cells
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit-Alexa Fluor 488
Secondary antibody dilution: 1:500

How do Aviva's reagents play a role in your experimental goals? Identifying which nuclear envelope proteins are expressed in various mouse tissue.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4... detects Lamin B2 as do other antibodies we routinely use.
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
How did you store the antibody after re-suspension?  -20 degree C
Sample Description (please include species type and tissue/cell type): Mouse C2C12 cells
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? paraformaldehyde 2.5% in PBS
How many different experimental trials were conducted using the antibody sample? 1
Primary antibody dilution, incubation time and temperature: 1:500, 1 hour, room temp.
Secondary antibody used, dilution, incubation time and temperature: goat alex488, 1:500, 1 hour, RT
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: Lamin B2= green, DAPI= Blue
Did you use an antigen retrieval method? If so, please explain? No
What controls were used in your experiment? Antibodies that we have previously used
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...