Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP46356_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46356_P050-FITC Conjugated

ARP46356_P050-HRP Conjugated

ARP46356_P050-Biotin Conjugated

LMNB2 Antibody - N-terminal region (ARP46356_P050)

Rating:
80% of 100
Catalog#: ARP46356_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-121281 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LMNB2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 92%
Complete computational species homology data Anti-LMNB2 (ARP46356_P050)
Peptide Sequence Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LMNB2 (ARP46356_P050) antibody is Catalog # AAP46356 (Previous Catalog # AAPP27142)
Datasheets/Manuals Printable datasheet for anti-LMNB2 (ARP46356_P050) antibody
Sample Type Confirmation

LMNB2 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Tsai,M.Y., (2006) Science 311 (5769), 1887-1893
Publications

Jacinto, FV; Benner, C; Hetzer, MW; The nucleoporin Nup153 regulates embryonic stem cell pluripotency through gene silencing. 29, 1224-38 (2015). WB, IHC, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26080816

Gene Symbol LMNB2
Official Gene Full Name Lamin B2
Alias Symbols LAMB2, LMN2, MGC2721
NCBI Gene Id 84823
Protein Name Lamin-B2
Description of Target The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B2. This gene is in a head-to-tail orientation with the gene for the translocase of inner mitochondrial membrane 13 homolog gene.
Swissprot Id Q03252
Protein Accession # NP_116126
Nucleotide Accession # NM_032737
Protein Size (# AA) 600
Molecular Weight 68kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LMNB2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LMNB2.
Protein Interactions UBC; GPRASP2; SUZ12; EED; RNF2; LMNA; PAN2; VCP; UBD; SIRT7; ELAVL1; SVIL; BANF1; PRKCD; LMNB2; TMPO; XRCC5; ORC2;
Write Your Own Review
You're reviewing:LMNB2 Antibody - N-terminal region (ARP46356_P050)
Your Rating