Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LMAN2 antibody - N-terminal region (ARP46788_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP46788_P050-FITC Conjugated

ARP46788_P050-HRP Conjugated

ARP46788_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
LMAN2
NCBI Gene Id:
10960
Official Gene Full Name:
Lectin, mannose-binding 2
Protein Name:
Vesicular integral-membrane protein VIP36
Swissprot Id:
Q12907
Protein Accession #:
NP_006807
Nucleotide Accession #:
NM_006816
Alias Symbols:
C5orf8, GP36B, VIP36
Replacement Item:
This antibody may replace item HPA003927
Description of Target:
LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Protein Size (# AA):
356
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LMAN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LMAN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human LMAN2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-LMAN2 (ARP46788_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; RPA1; RPA3; RPA2; ATP4A; env; FRAT1; UBL4A; SUPT5H; MAPK9; FLOT1; ATP13A2; ISG15;
Blocking Peptide:
For anti-LMAN2 (ARP46788_P050) antibody is Catalog # AAP46788 (Previous Catalog # AAPP27586)
Datasheets/Manuals:
Printable datasheet for anti-LMAN2 (ARP46788_P050) antibody
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.
Target Reference:
Breuza,L., (2004) J. Biol. Chem. 279 (45), 47242-47253

Tell us what you think about this item!

Write A Review
    Please, wait...