Search Antibody, Protein, and ELISA Kit Solutions

LMAN2 Antibody - N-terminal region (ARP46788_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46788_P050-FITC Conjugated

ARP46788_P050-HRP Conjugated

ARP46788_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Lectin, mannose-binding 2
NCBI Gene Id:
Protein Name:
Vesicular integral-membrane protein VIP36
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C5orf8, GP36B, VIP36
Replacement Item:
This antibody may replace item HPA003927
Description of Target:
LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LMAN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LMAN2.
The immunogen is a synthetic peptide directed towards the N terminal region of human LMAN2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-LMAN2 (ARP46788_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LMAN2 (ARP46788_P050) antibody is Catalog # AAP46788 (Previous Catalog # AAPP27586)
Printable datasheet for anti-LMAN2 (ARP46788_P050) antibody
Target Reference:
Breuza,L., (2004) J. Biol. Chem. 279 (45), 47242-47253

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...